PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676731724
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family NF-YB
Protein Properties Length: 176aa    MW: 19203.3 Da    PI: 6.9472
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676731724genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB183.91.2e-5730127198
      NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegekk 98 
                vreqdrflPian+srimk+ lPan+ki+kdaket+qecvsefisf+tseasdkcqrekrktingddllwa++tlGfedyveplk+yl kyre+eg++k
  676731724  30 VREQDRFLPIANISRIMKRGLPANGKIAKDAKETMQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMTTLGFEDYVEPLKLYLIKYREMEGDNK 127
                69*********************************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.108.3E-5527143IPR009072Histone-fold
SuperFamilySSF471131.5E-4133157IPR009072Histone-fold
PfamPF008085.3E-2836100IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.4E-216482No hitNo description
PROSITE patternPS0068506783IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.4E-2183101No hitNo description
PRINTSPR006152.4E-21102120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MADSQAKSSP GGGGGSHESG GEQSPRSLNV REQDRFLPIA NISRIMKRGL PANGKIAKDA  60
KETMQECVSE FISFITSEAS DKCQREKRKT INGDDLLWAM TTLGFEDYVE PLKLYLIKYR  120
EMEGDNKGSG KGGESSAKRD GQPSQFPQHG HQGSFSQGPY GNSQGSHMMV QMPNAE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B3e-4930121192Transcription factor HapC (Eurofung)
4g92_B3e-4930121192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1768271e-136AK176827.1 Arabidopsis thaliana mRNA for transcription factor NF-Y, CCAAT-binding - like protein, complete cds, clone: RAFL25-38-H16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006403703.11e-103hypothetical protein EUTSA_v10010755mg
SwissprotQ67XJ21e-101NFYBA_ARATH; Nuclear transcription factor Y subunit B-10
TrEMBLV4NG961e-103V4NG96_EUTSA; Uncharacterized protein
STRINGscaffold_402342.11e-101(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14802794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.11e-89nuclear factor Y, subunit B10